| Sequence: | MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
| Accession: | Q9UHF5 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells. |
