| Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Accession: | P48061 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from a solution containing 20 mM sodium citrate, 0.1 MNaCl, pH 4.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1α and SDF1β are identical except for the four residues present in the C-terminus of SDF1β but absent from SDF1α. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface; and can also bind syndecan4. SDF1 is known to influence lymphopoiesis; regulate patterning and cell number of neural progenitors; and promote angiogenesis. It also enhances the survival of myeloid progenitor cells. |
